OD1

OD1 is a spider-derived peptide containing a stabilized disulfide framework suitable for ion-channel interaction studies. Its compact structure supports high-resolution biophysical characterization. Hydrophobic surfaces contribute to membrane-binding behavior. Researchers apply it in toxin-evolution and structural analyses.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1110

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C308H466N90O95S8
M.W/Mr.
7206.1
Sequence
GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR(Modifications: Disulfide bridge: 13-64, 17-37, 23-47, 27-49, Arg-65 = C-terminal amide)

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicescGMP Peptide ServiceCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Analysis ServicesEpitope Mapping ServicesPeptide CDMOPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers