Keywords Search Google Search Search

Omega-lycotoxin-Gsp2671c

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	L13005
Sequence	EKSCITWRNSCMHNDKGCCFPWSCVCWSQTVSRNSSGKEKKCQCRLW

CAT#	Product Name	Inquiry
X11180	PM_2455013	Inquiry
X00068	CARPA_heart	Inquiry
X20200	UP_P84533	Inquiry
X08337	PM_16702607	Inquiry
X01490	PH1PO027_04	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of pergolide mesylate salt in Parkinson's disease

Pergolide mesylate salt , also known as 8-beta-((methylthio)methyl)-D-6-propylergoline methanesulfonate, is a ...

The Function of Cyclosporin A as an Immunosuppressant

Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...

Montirelin: a thyrotropin-releasing hormone analogue

Figure 1. The structural formula of montirelinMontirelin, an analog of thyrotrophin-releasing hormone (TRH) is m ...

Function of P11 in a protein chip system

P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...

Delmitide: A novel peptide with anti-inflammatory effect

Delmitide, also known as RDP58, is a novel D-amino acid decapeptide with anti-inflammatory effect. RDP58 is a te ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Length	47
Modifications	Disulfide bond(4)