Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | IWDAIFHGAKHFLHRLVNPGGKDAVKDVQQKQ |
Activity | Antibacterial, Antifungal |
Host Chemicals | Oreochromis niloticus |
Length | 32 |
1. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
2. Cationic cell-penetrating peptides are potent furin inhibitors
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.