Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C183H288N54O50S2 |
M.W/Mr. | 4108.8 |
Sequence | AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF |
Length | 34 |
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
3. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.