Peptide A5K

Peptide A5K contains a pattern of alanine residues capped by a lysine, generating a simple amphipathic motif. The sequence is useful for examining helix propensity and terminal charge effects. Researchers analyze its secondary-structure content using circular dichroism and computational modeling. Applications include minimalist-motif studies, peptide-material design, and charge-anchored helix engineering.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2853

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C182H275N55O48S
M.W/Mr.
4033.54
Sequence
One Letter Code:GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR
Three Letter Code:Gly-Leu-Phe-Glu-Lys-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg

Peptide A5K is a synthetic peptide compound designed for advanced biochemical research and functional studies. Structurally characterized by a specific amino acid sequence, it serves as a versatile molecular tool for probing peptide-protein interactions, modulating cellular pathways, and facilitating the development of novel biomolecular assays. Its defined sequence and physicochemical properties enable precise experimental manipulation, making it highly relevant for investigations into structure-activity relationships and the molecular mechanisms underlying peptide-mediated biological processes. Researchers value Peptide A5K for its reproducibility, stability, and adaptability across a variety of experimental platforms, positioning it as a valuable resource in peptide science and molecular biology.

Peptide-based receptor interaction studies: Peptide A5K is frequently employed in the exploration of ligand-receptor dynamics, particularly in systems where short synthetic peptides mimic or disrupt endogenous signaling motifs. By incorporating this peptide into binding assays, researchers can dissect the specificity and affinity of interactions with target proteins, such as receptors or enzymes. This approach is instrumental in mapping functional domains, elucidating signaling cascades, and identifying critical residues responsible for biological activity.

Enzyme substrate and inhibitor screening: The defined sequence of Peptide A5K makes it an ideal substrate or competitive inhibitor in enzymatic assays. Enzyme researchers utilize it to assess protease specificity, kinetic parameters, and cleavage site preferences. Its application in high-throughput screening enables the identification of novel modulators and the characterization of catalytic mechanisms, providing valuable insights for both fundamental enzymology and the development of enzyme-targeted technologies.

Peptide structure-activity relationship (SAR) analysis: In medicinal chemistry and peptide engineering, Peptide A5K is used to systematically examine how sequence modifications influence biological function. By introducing targeted substitutions or truncations, scientists can map the contributions of individual amino acids to overall activity, stability, and selectivity. This SAR-driven approach informs the rational design of optimized peptide analogs with enhanced properties for research and technology development.

Cellular uptake and trafficking studies: The physicochemical profile of Peptide A5K allows it to serve as a model compound for investigating peptide internalization, intracellular distribution, and trafficking pathways. Researchers employ it in cell-based assays to quantify uptake efficiency, endosomal escape, and subcellular localization. Insights gained from these studies support the design of peptide-based delivery systems and the development of strategies to improve cellular targeting.

Peptide conjugation and functionalization research: Peptide A5K is also utilized as a scaffold for chemical modification, enabling the attachment of fluorophores, affinity tags, or bioactive moieties. These conjugated derivatives are valuable tools for imaging, affinity purification, and targeted delivery applications. By leveraging its defined sequence and reactive groups, scientists can generate multifunctional peptide constructs to expand the utility of peptide-based technologies in analytical and preparative workflows.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesEpitope Mapping ServicesCustom Conjugation ServicePeptide Modification ServicescGMP Peptide ServicePeptide CDMOPeptide Nucleic Acids SynthesisPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers