Peptide A5K

Peptide A5K contains a pattern of alanine residues capped by a lysine, generating a simple amphipathic motif. The sequence is useful for examining helix propensity and terminal charge effects. Researchers analyze its secondary-structure content using circular dichroism and computational modeling. Applications include minimalist-motif studies, peptide-material design, and charge-anchored helix engineering.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2853

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C182H275N55O48S
M.W/Mr.
4033.54
Sequence
One Letter Code:GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR
Three Letter Code:Gly-Leu-Phe-Glu-Lys-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide Synthesis ServicescGMP Peptide ServicePeptide Analysis ServicesPeptide Modification ServicesCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers