Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
M.F/Formula | C182H275N55O48S |
M.W/Mr. | 4033.54 |
Sequence | One Letter Code:GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR Three Letter Code:Gly-Leu-Phe-Glu-Lys-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg |
2. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
4. TMEM16F and dynamins control expansive plasma membrane reservoirs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.