Home > Product > Catalog Peptides > Others > Peptide YY (canine, mouse, porcine, rat)

Others

Peptide YY (canine, mouse, porcine, rat)

Price Inquiry
CAT#
P04002
Sequence
YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
M.W/Mr.
4240.71
Molecular Formula
C190H288N54O57
Length
36

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.