Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | FFRHLFRGAKAIFRGARQGWRAHKVVSRYRNRDVPETDNNQEEP |
Activity | Antibacterial |
Host Chemicals | Morone chrysops x Morone saxatilis |
Length | 44 |
1. Myotropic activity of allatostatins in tenebrionid beetles
4. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.