CAT# | P15007 |
Sequence | EVNCTPGATFKNKCNTCRCGSNGRSASCTLMACPPGSY |
Length | 38 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P15013 | protease inhibitor PI-4 | Inquiry | ||
P15006 | protease inhibitor SGPI-5A | Inquiry | ||
P15016 | serine protease inhibitor pi-4B | Inquiry | ||
P15018 | serine protease inhibitor pi-4Cp | Inquiry | ||
P15011 | protease inhibitor PI-9 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...
GR 82334 is a spirolactam analog with the structure of [[(S, S) Pro-Leu (spiro-γ-lactam)]9,10, Trp11] Physalaemi ...
Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...
KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...
Margatoxin (MgTX) is a 39 amino acid peptide with significant sequence homology to charybdotoxin (ChTX), and ha ...