Keywords Search Google Search Search

Psyle E

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2043
Sequence	GVIPCGESCVFIPCISSVLGCSCKNKVCYRD
Activity	Anticancer

CAT#	Product Name	Inquiry
AF3060	Drosomycin-2	Inquiry
AF2115	Brevinin-2CG1 antimicrobial peptide precursor	Inquiry
AF1703	Ranatuerin-2B	Inquiry
AF1501	Hepcidin-1	Inquiry
AF1905	Vhr1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of Gonadorelin in Infertility

Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...

Function of lysipressin in diabetes insipidus

Figure 1. Chemical structure of lysipressinLysipressin ([Lys8]-vasopressin) has been identified in the North Ame ...

Function of leuprolide acetate in disorders of the reproductive system

Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...

Obtustatin: a potent selective α1β1 inhibitor

Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...

The Function of Dipeptide-4 in Human Skin

An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Psychotria leptothyrsa
Length	31