CAT# | P03018 |
M.F/Formula | C156H251N47O43S |
M.W/Mr. | 3505.07 |
Sequence | MERVEWLRKKLQDVHNFVALGAPLAPRDAGS |
Length | 31 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P03001 | Parathyroid Hormone (1-34), human, C-Terminal | Inquiry | ||
P03056 | [Nle8,18, Tyr34] Parathyroid Hormone (1-34), human | Inquiry | ||
P03030 | [Asn8, Leu18] Parathyroid Hormone (1-34), human | Inquiry | ||
P03045 | pTH (29-32) (human) | Inquiry | ||
P03055 | Hypercalcemia Malignancy Factor (1-34), amide, human | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...
PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal a ...
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...