Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C156H251N47O43S |
M.W/Mr. | 3505.07 |
Sequence | MERVEWLRKKLQDVHNFVALGAPLAPRDAGS |
Length | 31 |
1. Cationic cell-penetrating peptides are potent furin inhibitors
5. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.