CAT# | AF2927 |
Sequence | ASFPWSCPSLSGVCRKVCLPTELFFGPLGCGKGFLCGVSHFL |
Activity | Antimicrobial |
Host Chemicals | Sparus aurata | Length | 42 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1363 | Brevinin-1-OR4 | Inquiry | ||
AF2247 | Brevinin-2-AJ1 antimicrobial peptide precursor | Inquiry | ||
AF1464 | Dermaseptin-H5 | Inquiry | ||
AF2199 | Brevinin-2Tb | Inquiry | ||
AF2501 | CECD_BOMMO Cecropin-D precursor | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
4. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
5. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
GR 64349 is a selective and potent NK2 agonist (EC50 = 3.7 nM in rat colon) with activity comparable to that of ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...
Angiotensin Ⅱ is a kind of peptides generally produced by the hydrolysis of the angiotensin Ⅰ under the angioten ...