Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCCYRN |
Activity | Antibacterial |
Host Chemicals | Leiurus quinquestriatus |
Length | 37 |
2. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. TMEM16F and dynamins control expansive plasma membrane reservoirs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.