CAT# | C27006 |
M.F/Formula | C142H237N45O39S7 |
M.W/Mr. | 3423.1 |
Sequence | AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2 |
Length | 31 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
C27001 | ω-Conotoxin MVIIA | Inquiry | ||
C27008 | w-Agatoxin-TK | Inquiry | ||
C27010 | Biotinyl-EpsilonAhx-Omega-Conotoxin GVIA | Inquiry | ||
C27003 | Alpha-conotoxin GI | Inquiry | ||
C27012 | μ-Conotoxin GIIIA | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...
Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...
Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...
Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...