CAT# | C27006 |
M.F/Formula | C142H237N45O39S7 |
M.W/Mr. | 3423.1 |
Sequence | AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Etomidate, a highly selective intravenous anesthetic agent, was first synthesized at Janssen Pharmaceuticals in ...
Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...
Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...