Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GTTVVNSTFSIVLGNKGYICTVTVECMRNCSK |
Activity | Gram+, |
Host Chemicals | Streptococcus mutans GS5 |
Length | 32 |
3. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
4. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
5. Implications of ligand-receptor binding kinetics on GLP-1R signalling
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.