Home > Product > Antimicrobial Peptides > T07C4.4

Antimicrobial Peptides

CAT#
AF2448
Sequence
MTRILPCLFLVLLAAAPLLANPANPLNLKKHHGVF
Host Chemicals
Caenorhabditis elegans
Length
35
Activity
Antibacterial

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.