Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | TEAETWEGAGPSIQLQLQEVKTGKASQFFGLM-NH2 |
Length | 32 |
2. Myotropic activity of allatostatins in tenebrionid beetles
3. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
5. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.