γ - TAC4 (30 - 61) - -NH2

γ - TAC4 (30 - 61) - -NH2 is an amidated peptide fragment containing both aromatic and charged motifs relevant to neuropeptide interaction studies. Its extended length supports detailed conformational mapping. Amphipathic character promotes membrane-association modeling. Researchers use it in exploring structural determinants of tachykinin-family peptides.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: T01022

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
Sequence
TEAETWEGAGPSIQLQLQEVKTGKASQFFGLM-NH2
Length
32

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Synthesis ServicescGMP Peptide ServiceEpitope Mapping ServicesPeptide Analysis ServicesPeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers