Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt
Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt
Online Inquiry
| CAT# | A17054 |
| CAS | 115966-23-9 |
| M.F/Formula | C₁₄₅H₂₃₄N₅₂O₄₄S₃ |
| M.W/Mr. | 3505.98 |
| Sequence | One Letter Code: TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
three Letter Code: H-Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH trifluoroacetate salt (Disulfide bond) |
| Source# | Synthetic |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt
Required fields are marked with *
×
Ask a Question for Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
