Urodilatin (human)

Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt is a synthetic peptide fragment derived from the full-length atrial natriuretic peptide, used to study vasodilation and blood pressure regulation. The trifluoroacetate salt form improves solubility and stability. Researchers use it to investigate its role in fluid homeostasis and its effects on natriuretic receptors across different species.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: A17054

CAS No:115966-23-9

Synonyms/Alias:Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₄₅H₂₃₄N₅₂O₄₄S₃
M.W/Mr.
3505.98
Sequence
One Letter Code: TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
three Letter Code: H-Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH trifluoroacetate salt (Disulfide bond)
Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide Synthesis ServicesEpitope Mapping ServicesCustom Conjugation ServicePeptide CDMOcGMP Peptide ServicePeptide Modification ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers