Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C202H325N61O54S |
M.W/Mr. | 4504.3 |
Sequence | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
Length | 39 |
3. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
5. Implications of ligand-receptor binding kinetics on GLP-1R signalling
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.