TIP-39

TIP-39 is a parathyroid hormone 2 receptor ligand peptide with helix-promoting motifs and a conserved C-terminal region. Sequence architecture supports receptor-binding and activation modeling. Conformational analysis reveals amphipathic helices suited for GPCR engagement. Researchers employ it in neuroendocrine signaling and PTH2 receptor structural studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: P03042

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C202H325N61O54S
M.W/Mr.
4504.3
Sequence
SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Length
39

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide Synthesis ServicesCustom Conjugation ServicePeptide Analysis ServicesPeptide Modification ServicescGMP Peptide ServicePeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers