Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | RYGRSYAMSHMPMSRMGRKMYQNYMYRRMQATKMMQYH |
Length | 38 |
1. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
3. Cationic cell-penetrating peptides are potent furin inhibitors
4. Implications of ligand-receptor binding kinetics on GLP-1R signalling
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.