CAT No: C05043
CAS No: 124756-98-5
Synonyms/Alias: Tyr-CGRP I (human)
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C172H276N52O51S2 |
M.W/Mr. | 3952.6 |
Sequence | One Letter Code: YACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Cys3 and 8 bridge) three Letter Code: H-Tyr-Ala-Cys-Asp-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 (trifluoroacetate salt)(Cys3 and 8 bridge) |
Source# | Synthetic |
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.