Keywords Search Google Search Search

U1-sicaritoxin-Li1b

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	S14002
Sequence	ACKGEGVKGCYYEADDWCCKKTPCKCPAWSHERECRCTQPCNPSCR

CAT#	Product Name	Inquiry
X20587	UP_Q58T86	Inquiry
X04237	PM_11408525	Inquiry
X08716	PM_17307162	Inquiry
X20545	UP_Q46228	Inquiry
X03151	PM_10698266	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Brief introduction of insulin-like growth factors

IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...

Function of BIM 189 As An Antagonist

BIM 189 is one of the most potent bombesin antagonists known in the guinea pig and 3T3 cell systems but has 40% ...

Aclerastide [DSC127] as a Therapy for the Treatment of Diabetic Foot Ulcers

Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...

Function of the Econazole and its derivative

Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...

Function of pramlintide in diabetes

Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Length	46
Modifications	Arginine amide;Disulfide bond(4);