Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4039.6 |
Sequence | LSELDDRADALQAGASQFETSAAKLKRKYWWKNLK |
Length | 35 |
2. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
4. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.