Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDYPK |
Activity | Cancer cells |
Host Chemicals | Viscum album L |
Length | 46 |
SwissProt ID | PDB ID: 1JMN |
1. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
5. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.