Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GLFPKINKKKAKTGVFNIIKTVGKEAGMDLIRTGIDTIGCKIKGEC |
Activity | Gram+ & Gram-, |
Host Chemicals | pickerel frog, Rana palustris, North America |
Length | 46 |
1. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
2. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
3. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.