CAT# | AF3049 |
Sequence | YGLVLKYCPKIGYCSNTCSKTQIWATSHGCKMYCCLPASWKWK |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...
The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...
Deslorelin acetate, marketed under the trade names Ovuplant, SucroMate and Suprelorin, is an injectable gonadotr ...
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...
Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...