Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | ESDTVTCRKMKGKCSFLLCPFFKRSSGTCYNGLAKCCRPFW |
Activity | Antibacterial |
Host Chemicals | Gallus gallus |
Length | 41 |
SwissProt ID | Q0E4V3 |
1. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
3. Implications of ligand-receptor binding kinetics on GLP-1R signalling
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.