Home > Product > Antimicrobial Peptides > Gm anionic pept2

Antimicrobial Peptides

Gm anionic pept2

Price Inquiry
CAT#
AF3332
Sequence
ETESTPDYLKNIQQQLEEYTKNFNTQVQNAFDSDKIKSEVNNFIESLGKILNTEKKEAPK
Host Chemicals
wax moth, Galleria mellonella
Length
60
Activity
Gram+, Fungi,

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.