Home > Product > Catalog Peptides > Others > Hemopexin-like 1

Others

Hemopexin-like 1

Price Inquiry
CAT#
M13012
Sequence
FDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPE
Modifications
Disulfide bond(2)
Length
44

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.