CAT# | H20004 |
Sequence | DSSEEKRHRKRKKHHRGYFQQYQPYQRYPLNYPPAYPFP |
Length | 39 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
X14808 | PM_8454594 | Inquiry | ||
X03993 | PM_11212101 | Inquiry | ||
X00606 | PH1BS010_29 | Inquiry | ||
X14099 | PM_8032267 | Inquiry | ||
X00605 | PH1BS010_28 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...
The endocytosis of AMPA receptors (AMPARs) requires the GTPase activity of dynamin. Since it is now established ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...
Glucagon is a 29-amino acid peptide hormone that is synthesized in pancreatic α cells from the proglucagon precursor by proho ...