Huwentoxin XVI

Huwentoxin-XVI, a 39 amino acids peptide, is potent and selective N-type Ca2+ channel blocker (IC50 ~ 60 nM). It can selectively and reversibly block N-type Ca2+ channels, but it does not block T-type Ca2+ channels, K+ channels or Na+ channels. It shows analgesic effects in vivo.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1055

CAS No:1600543-88-1

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C196H292N50O56S6
M.W/Mr.
4437.13
Sequence
CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK(Disulfide bridge: Cys1- and Cys6,Cys8 and Cys21,Cys15 and Cys36)
Labeling Target
Calcium Channel
Appearance
White lyophilised solid
Purity
>98%
Activity
Blocker

Huwentoxin XVI is a peptide neurotoxin originally isolated from the venom of the Chinese bird spider Ornithoctonus huwena. As a member of the huwentoxin family, it is characterized by a compact, disulfide-rich structure and potent activity against voltage-gated ion channels. The unique peptide sequence and well-defined three-dimensional conformation of Huwentoxin XVI make it a valuable molecular tool for neuroscience and ion channel research. Its specificity and ability to modulate neuronal signaling pathways have attracted significant interest in both academic and industrial research settings, where it serves as a model system for studying peptide-channel interactions and neurotoxic mechanisms.

Ion Channel Research: Huwentoxin XVI is widely utilized as a selective probe for investigating the function and pharmacology of voltage-gated calcium and sodium channels. By binding to specific channel subtypes, it enables researchers to dissect the physiological roles of these channels in neuronal excitability, synaptic transmission, and signal propagation. The peptide's high affinity and subtype selectivity facilitate detailed mapping of ion channel distribution and function in various neural tissues, providing insights into the molecular basis of electrical signaling in the nervous system.

Neuropharmacology Studies: As a potent modulator of neuronal ion channels, Huwentoxin XVI is instrumental in neuropharmacological assays aimed at screening and characterizing novel channel modulators. Its defined mechanism of action allows for the assessment of compound efficacy, selectivity, and potential off-target effects in drug discovery pipelines targeting neurological disorders. Studies employing this peptide help elucidate the structure-activity relationships of channel blockers and contribute to the rational design of next-generation neuroactive agents.

Peptide Structure-Function Analysis: The distinctive disulfide-rich motif and compact fold of Huwentoxin XVI provide an excellent model for exploring the relationship between peptide structure and biological activity. Researchers frequently use it in mutagenesis and structural biology experiments to pinpoint residues critical for channel interaction, stability, and folding. These investigations not only advance understanding of toxin-channel recognition but also inform the engineering of novel peptides with tailored properties for research or biotechnological applications.

Venom Peptide Evolution: Comparative studies involving Huwentoxin XVI and related spider toxins support research into the molecular evolution and diversification of venom peptides. Its sequence and structural features serve as reference points for phylogenetic analyses, helping to trace adaptive changes that underlie toxin specialization and functional diversity. Such work enhances knowledge of venom evolution and informs broader studies of protein adaptation in response to ecological pressures.

Electrophysiological Assays: The peptide is routinely employed in patch-clamp and other electrophysiological techniques to modulate channel activity in cultured neurons, brain slices, or heterologous expression systems. Its use allows for precise control of ion channel function, enabling the measurement of current kinetics, gating properties, and pharmacological responses under controlled experimental conditions. These assays are fundamental to advancing the understanding of neuronal signaling mechanisms and assessing the functional impact of channel-targeted interventions.

Source#
Synthetic
InChI
InChI=1S/C196H292N50O56S6/c1-16-102(13)158-188(294)211-85-148(255)213-121(58-60-152(259)260)162(268)208-86-150(257)239-157(101(11)12)194(300)246-69-31-40-145(246)186(292)237-142-94-307-308-95-143-182(288)221-126(71-98(5)6)169(275)219-123(36-22-26-64-199)192(298)244-67-30-41-146(244)187(293)243-160(104(15)249)191(297)229-127(72-99(7)8)170(276)226-133(78-110-83-205-96-212-110)163(269)209-87-151(258)240-159(103(14)17-2)190(296)230-132(77-109-82-207-117-33-19-18-32-115(109)117)175(281)223-128(73-105-42-50-111(250)51-43-105)171(277)216-119(35-21-25-63-198)166(272)233-138(89-248)179(285)224-130(75-107-46-54-113(252)55-47-107)173(279)222-131(76-108-48-56-114(253)57-49-108)174(280)235-139(180(286)225-129(74-106-44-52-112(251)53-45-106)172(278)215-118(34-20-24-62-197)165(271)220-124(195(301)302)37-23-27-65-200)92-305-306-93-141(184(290)236-140(91-304-303-90-116(201)161(267)242-158)183(289)232-137(88-247)164(270)210-84-149(256)214-125(70-97(3)4)178(284)241-156(100(9)10)189(295)238-143)234-167(273)120(38-28-66-206-196(203)204)218-185(291)144-39-29-68-245(144)193(299)136(81-155(265)266)231-176(282)134(79-147(202)254)227-168(274)122(59-61-153(261)262)217-177(283)135(80-154(263)264)228-181(142)287/h18-19,32-33,42-57,82-83,96-104,116,118-146,156-160,207,247-253H,16-17,20-31,34-41,58-81,84-95,197-201H2,1-15H3,(H2,202,254)(H,205,212)(H,208,268)(H,209,269)(H,210,270)(H,211,294)(H,213,255)(H,214,256)(H,215,278)(H,216,277)(H,217,283)(H,218,291)(H,219,275)(H,220,271)(H,221,288)(H,222,279)(H,223,281)(H,224,285)(H,225,286)(H,226,276)(H,227,274)(H,228,287)(H,229,297)(H,230,296)(H,231,282)(H,232,289)(H,233,272)(H,234,273)(H,235,280)(H,236,290)(H,237,292)(H,238,295)(H,239,257)(H,240,258)(H,241,284)(H,242,267)(H,243,293)(H,259,260)(H,261,262)(H,263,264)(H,265,266)(H,301,302)(H4,203,204,206)
InChI Key
JEUFUDFTZMBKGH-UHFFFAOYSA-N
References

In this study, a novel neurotoxin named Huwentoxin-XVI (HWTX-XVI) specific for N-type calcium channels was purified and characterized from the venom of Chinese tarantula Ornithoctonus huwena. HWTX-XVI is composed of 39 amino acid residues including six cysteines that constitute three disulfide bridges. HWTX-XVI could almost completely block the twitch response of rat vas deferens to low-frequency electrical stimulation.

Huwentoxin-XVI, an analgesic, highly reversible mammalian N-type calcium channel antagonist from Chinese tarantula Ornithoctonus huwena

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide CDMOPeptide Synthesis ServicesEpitope Mapping ServicescGMP Peptide ServicePeptide Analysis ServicesCustom Conjugation ServicePeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers