Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | SRHTGPGNGSGSGAGSGNPFRSPSSQQRPLYYDAPIGKPSKTMYA |
Length | 45 |
1. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
5. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.