Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | IMWVVGGYMFNHSDYNMVLAYDLASREWLPLNRSVNNVVVRYGHSLALYKD |
Length | 51 |
3. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
4. Cationic cell-penetrating peptides are potent furin inhibitors
5. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.