Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | ALYVHGGYKAFSANKYRLADDLYRYDVDTQMWTILKDSRFFRYLHTAVIVSG |
Length | 52 |
3. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
4. TMEM16F and dynamins control expansive plasma membrane reservoirs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.