Keywords Search Google Search Search

Kelch 4

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A40005
Sequence	ALYVHGGYKAFSANKYRLADDLYRYDVDTQMWTILKDSRFFRYLHTAVIVSG

CAT#	Product Name	Inquiry
X09702	PM_1885582	Inquiry
X06942	PM_15313615_2	Inquiry
X03492	PM_10903129	Inquiry
X20806	UP_Q93WP8	Inquiry
X21060	VAPRG_ITG_avb6	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Abaloparatide Helps Osteoporotic Fractures Treatment

What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...

An undecapeptite of mollusk origin-Eledoisin

Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...

Potent blocker of voltage-gated sodium channels-Phrixotoxin 3

The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...

ProTx II, a selective inhibitor of NaV1.7 sodium channel

ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...

Function of dulaglutide in type 2 diabetes

Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: