Home > Product > Antimicrobial Peptides > Mussel Defensin MGD-1

Antimicrobial Peptides

Mussel Defensin MGD-1

Price Inquiry
CAT#
AF2770
Sequence
GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLPCTCYRCG
Host Chemicals
Mediterranean mussel, Mytilus galloprovincialis
Length
39
Activity
Gram+,
SwissProt ID
PDB ID: 1FJN

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.