Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C181H291N55O51S2 |
M.W/Mr. | 4117.8 |
Sequence | One Letter Code: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF three Letter Code: H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH (trifluoroacetate salt) |
Source# | Synthetic |
Length | 34 |
1. TMEM16F and dynamins control expansive plasma membrane reservoirs
5. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.