Tel: 1-631-624-4882
Email: info@creative-peptides.com

Parathyroid Hormone (1-34), human

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

cGMP Peptide

Registration of APIs CMC information required for an IND

IND and NDA support Drug master files (DMF) filing

M.F/FormulaC181H291N55O51S2
M.W/Mr.4117.8
SequenceOne Letter Code: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
three Letter Code: H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH (trifluoroacetate salt)
Source#Synthetic
Length34
Write a review Ask a question
My Review for Parathyroid Hormone (1-34), human

Required fields are marked with *

  • Basic Information
×
Ask a Question for Parathyroid Hormone (1-34), human

Required fields are marked with *

  • Basic Information
×
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Elcatonin Acetate

    Elcatonin acetate inhibits the absorption and autolysis of bones, thus leads to blood calcium descending. In addition, it inhibits the bone salts dissolving and transferring and promotes the excretion of calcium and phosphorus in urine.

    Inquiry
  • Gonadorelin Acetate

    Gonadorelin is a trophic peptide hormone responsible for the release of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) from the anterior pituitary. GnRH is synthesized and released from GnRH neurons within the hypothalamus. The peptide belongs to gonadotropin-releasing hormone family. It constitutes the initial step in the hypothalamic–pituitary–gonadal axis.

    Inquiry
  • Teduglutide

    Teduglutide is a polypeptide consisting of 33 amino acids. It is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.

    Inquiry
  • GLP-1 (7-36) amide Acetate

    Glucagon-like peptide-1 (GLP-1) is an incretin derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-1 as a gut hormone. Its physiological functions include promoting insulin sensitivity, decreasing food intake by increasing satiety in brain and increasing insulin secretion from the pancreas in a glucose-dependent manner.

    Inquiry
  • Antide

    Antide acetate (Ac-AA10-NH2) is an LHRH antagonist and represses LH and FSH release from the pituitary gland. It shows a high antiovulatory activity and releases negligible histamine.

    Inquiry
  • Buserelin Acetate

    Buserelin Acetate is an agonist of gonadotropin-releasing hormone receptor(GnRHR). Buserelin is a synthetic luteinizing hormone–releasing hormone (LHRH) analog.

    Inquiry
  • Teriparatide Acetate

    Teriparatide(recombinant human parathyroid hormone) /PTH (1-34) (human) corresponds to the N-terminal part of human parathyroid hormone, a peptide consisting of 84 amino acids.

    Inquiry
  • Terlipressin

    Terlipressin is a synthetic triglycyllysine derivative of vasopressin with vasoconstrictive, antihemorrhagic, and antidiuretic properties. Upon intravenous administration, terlipressin, an inactive prodrug, is biotransformed to its active moiety, lysine vasopressin (LVP), a nonselective vasopressin analogue with affinity for vasopressin receptors V1 (V1a), V2 and V3 (V1b). As a V1 agonist, terlipressin increases systemic vascular resistance, particularly in the splanchnic area, resulting in a decrease of portal pressure. V1 binding also promotes platelet aggregation and glycogenolysis, while V3 binding induces adrenocorticotropic hormone (ACTH) secretion. Compared to vasopressin, terlipressin has a minimal effect on V2 receptors, which are responsible for promotion of water reabsorption in the collecting ducts of the kidney via stimulation of cyclic AMP production.

    Inquiry
  • Somatostatin

    Somatostatin is a tetradecapeptide which can suppress the growth hormone (GH) secretion and control the pituitary hormone secretion in human CNS.

    Inquiry
  • Terlipressin Acetate

    Terlipressin acetate is a vasopressin analogue with potent vasoactive properties. Terlipressin acetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin acetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin acetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research.

    Inquiry
  • Elcatonin Acetate

    Elcatonin acetate inhibits the absorption and autolysis of bones, thus leads to blood calcium descending. In addition, it inhibits the bone salts dissolving and transferring and promotes the excretion of calcium and phosphorus in urine.

    Inquiry
  • Gonadorelin Acetate

    Gonadorelin is a trophic peptide hormone responsible for the release of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) from the anterior pituitary. GnRH is synthesized and released from GnRH neurons within the hypothalamus. The peptide belongs to gonadotropin-releasing hormone family. It constitutes the initial step in the hypothalamic–pituitary–gonadal axis.

    Inquiry
  • Teduglutide

    Teduglutide is a polypeptide consisting of 33 amino acids. It is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.

    Inquiry
  • GLP-1 (7-36) amide Acetate

    Glucagon-like peptide-1 (GLP-1) is an incretin derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-1 as a gut hormone. Its physiological functions include promoting insulin sensitivity, decreasing food intake by increasing satiety in brain and increasing insulin secretion from the pancreas in a glucose-dependent manner.

    Inquiry
  • Antide

    Antide acetate (Ac-AA10-NH2) is an LHRH antagonist and represses LH and FSH release from the pituitary gland. It shows a high antiovulatory activity and releases negligible histamine.

    Inquiry

About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

FAQ
Trusted By Over 1500

Our Customers

Get in touch with us

USA

Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA

Tel: 1-631-624-4882

Fax: 1-631-614-7828

Email: info@creative-peptides.com

 

Germany

Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main

Email: info@creative-peptides.com

Copyright © 2025 Creative Peptides. All rights reserved.