CAT# | P03048 |
M.F/Formula | C225H366N68O61S2 |
M.W/Mr. | 5064.0 |
Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPR |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Basic Fibroblast Growth Factor, Human, called basic fibroblast growth factor (bFGF/FGF-b/FGF-2), is a single cha ...
Overview of the kinin system Kinins are peptide hormones that are formed as part of the kinin-kallikrein system (KKS). kinin ...
Figure 1. The structural formula of montirelinMontirelin, an analog of thyrotrophin-releasing hormone (TRH) is m ...
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...