Home > Product > Catalog Peptides > Others > Parathyroid Hormone (1-44), human

Others

Parathyroid Hormone (1-44), human

Price Inquiry
CAT#
P03048
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPR
M.W/Mr.
5064.0
Molecular Formula
C225H366N68O61S2
Length
44

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.