Products
Home > Functional Peptides > Cell Penetrating Peptides > Various Peptides > Parstatin (human)

If you find Creative Peptides is useful to satisfy your needs, please do not hesitate to contact us!

Parstatin (human)

CAT#
GR2141
Synonyms/Alias
Cell-permeable peptide cleaved from protease-activated receptor 1 (PAR1) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC50 ~ 3 μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro. Inhibits angiogenesis and exhibits cardioprotective activity in vivo.
CAS No.
1065755-99-8
Sequence
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR
M.W/Mr.
4467.29
Molecular Formula
C191H330N64O53S3
Storage
-20°C

Useful Tools

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
Customer Support & Price Inquiry
  • Please enter the code "peptides"

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

Follow us on:

Copyright © 2008 - Creative Peptides. All rights reserved.

USA

Address: 45-16 Ramsey Road, Shirley, NY 11967, USA

Tel: 1-631-624-4882

Fax: 1-631-614-7828

E-Mail:

Europe

Tel: 44-207-097-1828

E-Mail: