Home > Product > Antimicrobial Peptides > Penaeidin-4C

Antimicrobial Peptides

Penaeidin-4C

Price Inquiry
CAT#
AF3240
Sequence
YSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHR
Host Chemicals
Atlantic white shrimp, Litopenaeus setiferus (formerly Penaeus setiferus)
Length
47
Activity
Gram+, Fungi,
SwissProt ID
SwissProt ID: Q963C3

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.