Prepro-Atrial Natriuretic Factor (26-55) (human)
Prepro-Atrial Natriuretic Factor (26-55) (human)
Online Inquiry
| CAT# | A17053 |
| CAS | 112160-82-4 |
| M.F/Formula | C₁₅₂H₂₃₆N₃₈O₅₁S₃ |
| M.W/Mr. | 3507.97 |
| Sequence | One Letter Code: NPMYNAVSNADLMDFKNLLDHLEEKMPLED
three Letter Code: H-Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp-OH |
| Source# | Synthetic |
Length | 30 |
Storage | -20 ± 5 °C |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| A17013 |
Atrial Natriuretic Peptide (4-24), frog |
|
|
Inquiry |
| A17037 |
(Cys¹⁸)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt |
|
|
Inquiry |
| A17036 |
(Arg⁶,β-cyclohexyl-Ala⁸,D-Tic¹⁶,Arg¹⁷,Cys¹⁸)-Atrial Natriuretic Factor (6-18) amide (mouse, rabbit, rat) trifluoroacetate salt |
|
|
Inquiry |
| A17025 |
ANP (3-28), rat |
|
|
Inquiry |
| A17024 |
Atrial Natriuretic Polypeptide (4-28), human |
|
|
Inquiry |
Write a review
Ask a question
My Review for Prepro-Atrial Natriuretic Factor (26-55) (human)
Required fields are marked with *
×
Ask a Question for Prepro-Atrial Natriuretic Factor (26-55) (human)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
