1. Home
  2. Products
  3. Catalog Peptides
  4. Others Catalog Peptides
  5. pTH (1-38) (human)

pTH (1-38) (human)

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: P6923

CAS No:78232-94-7

Synonyms/Alias:Parathyroid Hormone (1-38), human; 78232-94-7

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
4458.2
Sequence
One Letter Code:SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG
Three Letter Code: H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-OH
InChI
InChI=1S/C197H319N59O55S2/c1-26-105(22)159(256-175(291)124(53-58-152(270)271)230-190(306)143(91-259)251-194(310)156(102(16)17)252-161(277)113(201)89-257)195(311)234-121(50-55-145(203)261)170(286)238-130(71-98(8)9)178(294)231-126(60-67-313-25)173(289)244-136(77-110-85-212-93-220-110)182(298)246-138(79-146(204)262)184(300)236-128(69-96(4)5)162(278)217-87-149(265)223-115(44-32-35-61-198)164(280)243-135(76-109-84-211-92-219-109)181(297)240-132(73-100(12)13)179(295)245-140(81-148(206)264)186(302)250-142(90-258)189(305)232-125(59-66-312-24)172(288)228-122(51-56-150(266)267)168(284)226-119(48-39-65-215-197(209)210)174(290)253-157(103(18)19)192(308)233-123(52-57-151(268)269)171(287)242-134(75-108-83-216-114-43-31-30-42-112(108)114)180(296)239-131(72-99(10)11)176(292)227-118(47-38-64-214-196(207)208)166(282)224-116(45-33-36-62-199)165(281)225-117(46-34-37-63-200)167(283)237-129(70-97(6)7)177(293)229-120(49-54-144(202)260)169(285)248-141(82-153(272)273)188(304)255-158(104(20)21)193(309)249-137(78-111-86-213-94-221-111)183(299)247-139(80-147(205)263)185(301)241-133(74-107-40-28-27-29-41-107)187(303)254-155(101(14)15)191(307)222-106(23)160(276)235-127(68-95(2)3)163(279)218-88-154(274)275/h27-31,40-43,83-86,92-106,113,115-143,155-159,216,257-259H,26,32-39,44-82,87-91,198-201H2,1-25H3,(H2,202,260)(H2,203,261)(H2,204,262)(H2,205,263)(H2,206,264)(H,211,219)(H,212,220)(H,213,221)(H,217,278)(H,218,279)(H,222,307)(H,223,265)(H,224,282)(H,225,281)(H,226,284)(H,227,292)(H,228,288)(H,229,293)(H,230,306)(H,231,294)(H,232,305)(H,233,308)(H,234,311)(H,235,276)(H,236,300)(H,237,283)(H,238,286)(H,239,296)(H,240,297)(H,241,301)(H,242,287)(H,243,280)(H,244,289)(H,245,295)(H,246,298)(H,247,299)(H,248,285)(H,249,309)(H,250,302)(H,251,310)(H,252,277)(H,253,290)(H,254,303)(H,255,304)(H,256,291)(H,266,267)(H,268,269)(H,270,271)(H,272,273)(H,274,275)(H4,207,208,214)(H4,209,210,215)/t105-,106-,113-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,155-,156-,157-,158-,159-/m0/s1
InChI Key
CKAOYTSBPACBHV-VQBQJPKLSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide CDMOcGMP Peptide ServicePeptide Analysis ServicesPeptide Synthesis ServicesCustom Conjugation ServicePeptide Nucleic Acids SynthesisEpitope Mapping Services
Hot Products
Deslorelin Acetate

Deslorelin Acetate is a potent GnRH analog peptide for fertility control research. Order Deslorelin peptide from a professional peptide supplier for veterinary applications.

Read More Read More
Buserelin Acetate

Buserelin Acetate is a GnRH agonist peptide regulating reproductive hormones. Buy Buserelin peptide powder online to explore fertility and hormone-dependent tumor research.

Read More Read More
Carperitide

Carperitide is a human atrial natriuretic peptide analog for heart and kidney research. Buy Carperitide peptide online to study diuretic and cardiovascular effects.

Read More Read More
Carbetocin

Carbetocin is a synthetic oxytocin analog that promotes uterine contraction and postpartum recovery. Buy Carbetocin peptide powder from a professional supplier for reproductive research.

Read More Read More
Terlipressin

Terlipressin is a synthetic vasopressin analog that supports vascular and renal research. Purchase Terlipressin peptide from a verified supplier for liver and hemodynamic studies.

Read More Read More
Thymopentin Acetate

Thymopentin Acetate peptide enhances immune modulation and T-cell function. Purchase Thymopentin research peptide online for immunotherapy and cell biology research.

Read More Read More
GLP-1 (7-36) amide Acetate

GLP-1 (7-36) amide Acetate peptide enhances insulin secretion and glucose balance. Buy this research peptide for diabetes and metabolic disorder studies.

Read More Read More
Elcatonin Acetate

Elcatonin Acetate is a calcitonin analog supporting bone metabolism research. Buy Elcatonin peptide online to study calcium regulation and osteoporosis.

Read More Read More
Alarelin acetate

Alarelin Acetate is a high-purity synthetic peptide used in fertility and ovulation research. Buy Alarelin peptide online from a trusted peptide supplier for advanced hormonal studies.

Read More Read More
Atosiban

Atosiban is a peptide oxytocin receptor antagonist that helps prevent preterm labor. Buy Atosiban peptide for reproductive and uterine contractility research.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers