CAT# | AF2651 |
Sequence | KYYGNGVSCNSHGCSVNWGQAWTCGVNHLANGGHGVC |
Activity | Antibacterial |
Host Chemicals | Lactobacillus sakei 2512 | Length | 37 | SwissProt ID | B2LS02 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1130 | Antimicrobial peptide odorranin-HP | Inquiry | ||
AF661 | PCM19 | Inquiry | ||
AF1245 | Brevinin-1Bb | Inquiry | ||
AF2266 | Brevinin-2SN2 | Inquiry | ||
AF055 | Theta defensin subunit B | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...
Lecirelin, a synthetic hormone, is a strongly basic nonapeptide with sequence yr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-A ...
Tetracosactide (also known as Tetracosactide) is a synthetic peptide that is identical to the 24-amino acid segm ...
Jingzhaotoxin-III (β-TRTX-Cj1α) is a kind of sodium channel gating modifier which is from the tarantula Chilobra ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...