Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | SISCGESCAMISFCFTEVIGCSCKNKVCYLN |
Activity | Antiviral |
Host Chemicals | Viola hederacea |
Length | 31 |
SwissProt ID | P84522 |
2. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
5. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.