Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C147H238N44O42S |
M.W/Mr. | 3325.84 |
Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
Length | 28 |
1. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
2. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.