CAT# | AF3095 |
Sequence | KVSGGEAVAAIGICATASAAIGGLAGATLVTPYCVGTWGLIRSH |
Activity | Antibacterial |
Host Chemicals | Streptococcus mutans UA140 | Length | 44 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1630 | Antibacterial peptide BMAP-27 | Inquiry | ||
AF2648 | Plantaricin C19 | Inquiry | ||
AF1135 | Plasticin ANCKF | Inquiry | ||
AF824 | Maximin-Hw | Inquiry | ||
AF1248 | Brevinin-1BLa | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...
An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...
GLP-1 is a 30 amino acid peptide (molecular weight of 3297.5) secreted by intestinal L-cells in response to meal ingestion wi ...
BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...
Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...