Home > Product > Catalog Peptides > Others > PHI-27 (porcine)

Others

PHI-27 (porcine)

Price Inquiry
CAT#
V02012
Sequence
HADGVFTSDFSRLLGQLSAKKYLESLI-NH2
M.W/Mr.
2995.43
Molecular Formula
C136H216N36O40
Length
27

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.