ProTx I

ProTx I is potent, selective CaV3.1 channel blocker. It also reversibly inhibits NaV1.8 and KV2.1 channels.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R0936

CAS No:484598-35-8

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C171H245N53O47S6
M.W/Mr.
3987.51
Sequence
ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS(Disulfide bridge: Cys2 and Cys16, Cys9 and Cys21, Cys15 and Cys28)
Labeling Target
CaV3.1 channel
Appearance
White lyophilised solid
Purity
>98%
Activity
Inhibitor

ProTx I is a peptide toxin originally isolated from the venom of the tarantula Thrixopelma pruriens, recognized for its potent and selective modulation of voltage-gated sodium channels (Nav channels). As a cystine knot peptide, ProTx I exhibits a stable tertiary structure, which contributes to its high affinity and specificity toward particular Nav channel subtypes. Its unique molecular architecture and bioactivity have established ProTx I as a valuable tool in neurophysiological research, enabling detailed investigations into ion channel function and pharmacology. The compound's ability to alter neuronal excitability at the molecular level has spurred widespread interest in both basic and applied research contexts.

Ion Channel Pharmacology: ProTx I is widely employed in the study of voltage-gated sodium channel subtypes, especially Nav1.7, Nav1.8, and related isoforms. Its mechanism of action involves binding to the voltage-sensor domains of these channels, thereby modulating their gating properties and inhibiting channel activation. Researchers utilize the peptide to dissect the structural determinants of channel modulation, to map functional domains, and to screen for small-molecule modulators with therapeutic potential. Its selectivity profile makes it particularly useful for distinguishing between closely related sodium channel subtypes in electrophysiological and biochemical assays.

Neurophysiology Research: The ability of ProTx I to modulate neuronal excitability makes it a critical reagent for exploring the physiological and pathophysiological roles of sodium channels in the nervous system. Investigators leverage its activity to probe the contribution of specific Nav channel subtypes to action potential initiation and propagation, synaptic transmission, and neuronal signaling pathways. The peptide is frequently applied in patch-clamp electrophysiology, calcium imaging, and related techniques to elucidate the dynamics of neuronal firing and excitability under various experimental conditions.

Peptide Toxin Structure-Function Analysis: ProTx I serves as a model system for structure-function studies of peptide toxins. Its well-defined disulfide-rich scaffold provides an excellent template for mutagenesis and analog development, enabling researchers to investigate the relationship between molecular structure and channel-modulating activity. Such studies contribute to a deeper understanding of toxin-channel interactions and facilitate the rational design of novel peptide-based modulators with improved selectivity or altered pharmacological profiles.

Peptide Synthesis and Engineering: The robust cystine knot framework of ProTx I has inspired its use in peptide engineering and synthetic biology. Researchers exploit its structural stability to design and synthesize analogs or chimeric peptides with tailored biological properties. These efforts support the development of new molecular probes, research tools, and prototype scaffolds for ion channel modulation, expanding the utility of peptide toxins in chemical biology and drug discovery.

Analytical and Screening Applications: ProTx I is employed in various analytical platforms, including high-throughput screening assays and binding studies. Its high specificity for certain sodium channel subtypes allows it to serve as a reference ligand or positive control when assessing the activity of novel compounds or biologics targeting ion channels. By providing a benchmark for channel inhibition or modulation, the peptide supports the validation and optimization of assay systems in both academic and industrial research settings.

Source#
Synthetic
Long-term Storage Conditions
Soluble in water
Solubility
-20 °C
InChI
InChI=1S/C171H245N53O47S6/c1-81(2)50-108-141(243)191-65-128(232)189-66-129(233)199-121-73-272-275-76-124-161(263)214-119(71-226)157(259)201-104(35-23-47-183-169(175)176)144(246)200-105(36-24-48-184-170(177)178)147(249)208-115(57-93-63-181-79-194-93)142(244)192-68-131(235)198-112(54-90-60-186-100-31-18-15-28-96(90)100)151(253)217-126(163(265)223-135(83(5)6)164(266)212-114(56-92-62-188-102-33-20-17-30-98(92)102)153(255)210-117(59-134(239)240)143(245)193-69-132(236)221-137(86(10)228)166(268)211-111(52-88-26-13-12-14-27-88)150(252)215-120(72-227)168(270)271)78-277-276-77-125(220-167(269)138(87(11)229)224-148(250)107(43-44-127(174)231)197-130(234)67-190-139(241)85(9)196-156(258)118(70-225)213-158(121)260)162(264)218-123(160(262)202-103(34-21-22-46-172)145(247)209-116(58-94-64-182-80-195-94)154(256)205-109(51-82(3)4)155(257)222-136(84(7)8)165(267)219-124)75-274-273-74-122(216-140(242)99(173)42-45-133(237)238)159(261)203-106(37-25-49-185-171(179)180)146(248)206-110(53-89-38-40-95(230)41-39-89)149(251)207-113(152(254)204-108)55-91-61-187-101-32-19-16-29-97(91)101/h12-20,26-33,38-41,60-64,79-87,99,103-126,135-138,186-188,225-230H,21-25,34-37,42-59,65-78,172-173H2,1-11H3,(H2,174,231)(H,181,194)(H,182,195)(H,189,232)(H,190,241)(H,191,243)(H,192,244)(H,193,245)(H,196,258)(H,197,234)(H,198,235)(H,199,233)(H,200,246)(H,201,259)(H,202,262)(H,203,261)(H,204,254)(H,205,256)(H,206,248)(H,207,251)(H,208,249)(H,209,247)(H,210,255)(H,211,268)(H,212,266)(H,213,260)(H,214,263)(H,215,252)(H,216,242)(H,217,253)(H,218,264)(H,219,267)(H,220,269)(H,221,236)(H,222,257)(H,223,265)(H,224,250)(H,237,238)(H,239,240)(H,270,271)(H4,175,176,183)(H4,177,178,184)(H4,179,180,185)
InChI Key
TYAZSKURKBASCY-UHFFFAOYSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOEpitope Mapping ServicesPeptide Synthesis ServicesCustom Conjugation ServicePeptide Modification ServicesPeptide Analysis ServicescGMP Peptide ServicePeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers