Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | PCALRTACGDCTSGSSECMWCSNMKQCVDSNAYVASFPFGQCMEWYTMSTCP |
Length | 52 |
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
5. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.