Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. Tat-Beclin-1, scrambled will not induce autophagy and can be used as a negative control. RELATED PRODUCTS:Tat-Beclin-1, Cat# 65467Beclin-1, Cat# 65466
CAT No: GR1215
Synonyms/Alias: Beclin-1 Activator I; TAT-Beclin-1, Scrambled; H?N-YGRKKRRQRRR-GG-VGNDFFINHETTGFATEW-CO?H;H-YGRKKRRQRRRGGVGNDFFINHETTGFATEW-OH;YGRKKRRQRRRGGVGNDFFINHETTGFATEW-acid;H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Val- Gly-Asn-Asp-Phe-Phe-Ile-Asn-His-Glu-T hr-Thr-Gly-Phe-Ala-Thr-Glu-Trp-OH;
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C164H251N57O45 |
M.W/Mr. | 3741.1 |
Sequence | One Letter Code: YGRKKRRQRRRGGVGNDFFINHETTGFATEW Three-Letter Code: Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Val-Gly-Asn-His-Phe-Phe-Ile-Asn-His-Ser-Thr-Thr-Gly-Phe-Ala-Thr-Gln-Trp-OH |
Purity | % Peak Area By HPLC ≥ 95% |
Size | 1 mg |
References | Shoji-Kawata, S. Nature 494, 201-209 (2013); Marquez, RT. Am J Cancer Res 2 (2), 214–221 (2012). |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.