Modified Growth Releasing Factor aminos 1-29, usually referred to as Modified GRF (1-29) or "ModGRF(1-29)," also known as CJC-1295 without DAC, is a synthetic analog of the endogenous peptide signaling hormone Growth Hormone Releasing Hormone (GHRH).
CAT# | HB00107 |
Chemical Structure | ![]() |
CAS | 863288-34-0 |
Synonyms/Alias | CJC-1295(2MG);CJC-1295(10mg);CJC-1295 Acetate;CJC-1295 CJC-1295;CJC1295 with out DAC;CJC-1295 Without DAC 86328-34-0;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl |
M.F/Formula | C152H252N44O42 |
M.W/Mr. | 3367.89688 |
Biological Activity | CJC-1295 without DAC is synthetic analog of Growth Hormone Releasing Factor (GRF) also known as Growth Hormone Releasing Hormone (GHRH). |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...
BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...
(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...
Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...