CJC1295 Without DAC
Modified Growth Releasing Factor aminos 1-29, usually referred to as Modified GRF (1-29) or "ModGRF(1-29)," also known as CJC-1295 without DAC, is a synthetic analog of the endogenous peptide signaling hormone Growth Hormone Releasing Hormone (GHRH).
Online Inquiry
| CAT# | HB00107 |
| Chemical Structure |  |
| CAS | 863288-34-0 |
| Synonyms/Alias | CJC-1295(2MG);CJC-1295(10mg);CJC-1295 Acetate;CJC-1295 CJC-1295;CJC1295 with out DAC;CJC-1295 Without DAC 86328-34-0;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl |
| M.F/Formula | C152H252N44O42 |
| M.W/Mr. | 3367.89688 |
| Biological Activity | CJC-1295 without DAC is synthetic analog of Growth Hormone Releasing Factor (GRF) also known as Growth Hormone Releasing Hormone (GHRH). |
| Storage | Desiccate at -20°C |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
Write a review
Ask a question
My Review for CJC1295 Without DAC
Required fields are marked with *
×
Ask a Question for CJC1295 Without DAC
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
