Modified Growth Releasing Factor aminos 1-29, usually referred to as Modified GRF (1-29) or "ModGRF(1-29)," also known as CJC-1295 without DAC, is a synthetic analog of the endogenous peptide signaling hormone Growth Hormone Releasing Hormone (GHRH).
CAT No:HB00107
CAS No:863288-34-0
Synonyms/Alias:CJC-1295(2MG);CJC-1295(10mg);CJC-1295 Acetate;CJC-1295 CJC-1295;CJC1295 with out DAC;CJC-1295 Without DAC 86328-34-0;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C152H252N44O42 |
M.W/Mr. | 3367.89688 |
Biological Activity | CJC-1295 without DAC is synthetic analog of Growth Hormone Releasing Factor (GRF) also known as Growth Hormone Releasing Hormone (GHRH). |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.