CJC1295 Without DAC

Modified Growth Releasing Factor aminos 1-29, usually referred to as Modified GRF (1-29) or "ModGRF(1-29)," also known as CJC-1295 without DAC, is a synthetic analog of the endogenous peptide signaling hormone Growth Hormone Releasing Hormone (GHRH).

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	HB00107
Chemical Structure
CAS	863288-34-0
Synonyms/Alias	CJC-1295(2MG);CJC-1295(10mg);CJC-1295 Acetate;CJC-1295 CJC-1295;CJC1295 with out DAC;CJC-1295 Without DAC 86328-34-0;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl
M.F/Formula	C152H252N44O42
M.W/Mr.	3367.89688
Biological Activity	CJC-1295 without DAC is synthetic analog of Growth Hormone Releasing Factor (GRF) also known as Growth Hormone Releasing Hormone (GHRH).

CAT#	Product Name	Inquiry
10-101-247	Cholecystokinin Octapeptide (desulfated)	Inquiry
10-101-326	Carfilzomib	Inquiry
10-101-208	GHRP-6	Inquiry
10-101-301	Asp-Leu	Inquiry
10-101-102	Depreotide	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Storage	Desiccate at -20°C
Shipping Condition	Room temperature in continental US; may vary elsewhere.