Sermorelin

Tetracosactide is a synthetic peptide, which corresponds to the first 24 amino acids of the naturally occurring hormone ACTH (adrenocorticotropic hormone). It stimulates the adrenal cortex to produce corticosteroids, mineralocorticoids, and, to a lesser extent, androgens.

Online Inquiry

CAT#HB00118
Chemical Structure
ExplanationSermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues
Synonyms/AliasSemorelin;SERMORELIN;Sermorelin Aceta;Sermelin Acetate;SERMORELIN ACETATE;GRF (1-29) AMIDE (HUMAN);GHRF (1-29), AMIDE, HUMAN;Green tea powdered extract;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;GRF (1-29) aMide (huMan) SerMorelin
M.F/FormulaC149H246N44O42S
M.W/Mr.3357.88
SequenceThree Letter Code: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Biological ActivitySermorelin, also known as GHRH (1-29), is a growth hormone-releasing hormone (GHRH) analogue used as a diagnostic agent. It is a 29-amino acid polypeptide representing the 1–29 fragment from endogenous human GHRH, and is thought to be the shortest fully functional fragment of GHRH.
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Contact Us

Address:

Tel: |

Email:

Copyright © 2022 Creative Peptides. All rights reserved.